Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DRAP1 mouse monoclonal antibody (hybridoma)

  • Catalog # : H00010589-M
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant DRAP1.
  • Immunogen:
  • DRAP1 (NP_006433.2, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactivity and specificity confirmed by ELISA and Western Blot.
  • Note:
  • Customer should check the viability of the hybridomas within one month from the date of receipt. Fee-for-service of long term hybridoma storage can be performed upon customer's request.
  • Deliverables:
  • Up to 5 positive hybridoma clones will be delivered to customer in the cryotube format.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DRAP1
  • Gene Alias:
  • NC2-alpha
  • Gene Description:
  • DR1-associated protein 1 (negative cofactor 2 alpha)
  • Gene Summary:
  • Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq
  • Other Designations:
  • DR1-associated corepressor,DR1-associated protein 1,negative cofactor 2 alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook