DRAP1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant DRAP1.
Immunogen
DRAP1 (NP_006433, 2 a.a. ~ 105 a.a) partial recombinant protein with GST tag.
Sequence
PSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.55 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DRAP1 polyclonal antibody (A01), Lot # 051019JCO1 Western Blot analysis of DRAP1 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — DRAP1
Entrez GeneID
10589GeneBank Accession#
NM_006442Protein Accession#
NP_006433Gene Name
DRAP1
Gene Alias
NC2-alpha
Gene Description
DR1-associated protein 1 (negative cofactor 2 alpha)
Omim ID
602289Gene Ontology
HyperlinkGene Summary
Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq
Other Designations
DR1-associated corepressor|DR1-associated protein 1|negative cofactor 2 alpha
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com