Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NPC2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00010577-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NPC2 protein.
  • Immunogen:
  • NPC2 (NP_006423.1, 1 a.a. ~ 151 a.a) full-length human protein.
  • Sequence:
  • MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • NPC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NPC2 expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • NPC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NPC2 expression in mouse lung.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • NPC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NPC2 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NPC2 expression in transfected 293T cell line (H00010577-T02) by NPC2 MaxPab polyclonal antibody.

    Lane 1: NPC2 transfected lysate(16.60 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • NPC2
  • Gene Alias:
  • HE1,MGC1333,NP-C2
  • Gene Description:
  • Niemann-Pick disease, type C2
  • Gene Summary:
  • This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq
  • Other Designations:
  • epididymal secretory protein,epididymal secretory protein E1,tissue-specific secretory protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook