CCT7 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CCT7 partial ORF ( AAH19296, 425 a.a. - 528 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.07
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCT7
Entrez GeneID
10574GeneBank Accession#
BC019296Protein Accession#
AAH19296Gene Name
CCT7
Gene Alias
CCT-ETA, Ccth, MGC110985, Nip7-1, TCP-1-eta
Gene Description
chaperonin containing TCP1, subunit 7 (eta)
Omim ID
605140Gene Ontology
HyperlinkGene Summary
This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date. [provided by RefSeq
Other Designations
HIV-1 Nef interacting protein|T-complex protein 1, eta subunit|chaperonin containing TCP1, subunit 7|chaperonin containing t-complex polypeptide 1, eta subunit
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com