MRPL28 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MRPL28 MaxPab polyclonal antibody. Western Blot analysis of MRPL28 expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of MRPL28 expression in transfected 293T cell line (H00010573-T02) by MRPL28 MaxPab polyclonal antibody.
Lane 1: MRPL28 transfected lysate(28.16 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MRPL28 protein.
Immunogen
MRPL28 (NP_006419.2, 1 a.a. ~ 256 a.a) full-length human protein.
Sequence
MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MRPL28 MaxPab polyclonal antibody. Western Blot analysis of MRPL28 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of MRPL28 expression in transfected 293T cell line (H00010573-T02) by MRPL28 MaxPab polyclonal antibody.
Lane 1: MRPL28 transfected lysate(28.16 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MRPL28
Entrez GeneID
10573GeneBank Accession#
NM_006428.3Protein Accession#
NP_006419.2Gene Name
MRPL28
Gene Alias
MAAT1, MGC8499, p15
Gene Description
mitochondrial ribosomal protein L28
Omim ID
604853Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein, a part of which was originally isolated by its ability to recognize tyrosinase in an HLA-A24-restricted fashion. [provided by RefSeq
Other Designations
OTTHUMP00000067337|melanoma antigen p15|melanoma-associated antigen recognised by cytotoxic T lymphocytes
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com