SIVA polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant SIVA.
Immunogen
SIVA (AAH34562, 1 a.a. ~ 110 a.a) full-length recombinant protein with GST tag.
Sequence
MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRPVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (75)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
ELISA
-
Gene Info — SIVA1
Entrez GeneID
10572GeneBank Accession#
BC034562Protein Accession#
AAH34562Gene Name
SIVA1
Gene Alias
CD27BP, SIVA, Siva-1, Siva-2
Gene Description
SIVA1, apoptosis-inducing factor
Omim ID
605567Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with an important role in the apoptotic (programmed cell death) pathway induced by the CD27 antigen, a member of the tumor necrosis factor receptor (TFNR) superfamily. The CD27 antigen cytoplasmic tail binds to the N-terminus of this protein. Two alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq
Other Designations
CD27-binding (Siva) protein
-
Interactome
-
Publication Reference
-
Helicobacter pylori pathogen regulates p14ARF tumor suppressor and autophagy in gastric epithelial cells.
Horvat A, Noto JM, Ramatchandirin B, Zaika E, Palrasu M, Wei J, Schneider BG, El-Rifai W, Peek RM Jr, Zaika AI.
Oncogene 2018 Sep; 37(37):5054.
Application:WB-Ce, Human, SNU1 cells.
-
Siva1 inhibits p53 function by acting as an ARF E3 ubiquitin ligase.
Wang X, Zha M, Zhao X, Jiang P, Du W, Tam AY, Mei Y, Wu M.
Nature Communications 2013 Mar; 4:1511.
Application:WB, Human, H1299 cells.
-
Actinomycin D upregulates proapoptotic protein Puma and downregulates Bcl-2 mRNA in normal peripheral blood lymphocytes.
Kalousek I, Brodska B, Otevrelova P, Roselova P.
Anticancer Drugs 2007 Aug; 18(7):763.
Application:WB, Human, Normal peripheral blood lymphocytes.
-
Immune escape for renal cell carcinoma: CD70 mediates apoptosis in lymphocytes.
Diegmann J, Junker K, Loncarevic IF, Michel S, Schimmel B, von Eggeling F.
Neoplasia 2006 Nov; 8(11):933.
Application:IHC, Human, A498, CAKI1, CAKI2 cells.
-
Helicobacter pylori pathogen regulates p14ARF tumor suppressor and autophagy in gastric epithelial cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com