Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARFGEF1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010565-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ARFGEF1 partial ORF ( NP_006412.2, 311 a.a. - 411 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EVLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.85
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010565-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ARFGEF1
  • Gene Alias:
  • ARFGEP1,BIG1,D730028O18Rik,DKFZP434L057,P200
  • Gene Description:
  • ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited)
  • Gene Summary:
  • ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. The protein encoded by this gene is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP. It contains a Sec7 domain, which may be responsible for the guanine-nucleotide exchange activity and also the brefeldin A inhibition. [provided by RefSeq
  • Other Designations:
  • brefeldin A-inhibited guanine nucleotide-exchange protein 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook