Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL13 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00010563-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CXCL13 protein.
  • Immunogen:
  • CXCL13 (NP_006410.1, 1 a.a. ~ 109 a.a) full-length human protein.
  • Sequence:
  • MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CXCL13 expression in transfected 293T cell line (H00010563-T02) by CXCL13 MaxPab polyclonal antibody.

    Lane 1: CXCL13 transfected lysate(12.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • CXCL13
  • Gene Alias:
  • ANGIE,ANGIE2,BCA-1,BCA1,BLC,BLR1L,SCYB13
  • Gene Description:
  • chemokine (C-X-C motif) ligand 13
  • Gene Summary:
  • B lymphocyte chemoattractant, independently cloned and named Angie, is a CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq
  • Other Designations:
  • B-cell chemoattractant,B-cell-attracting chemokine 1,B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1),B-lymphocyte chemoattractant,chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant),small inducible cytokine B subfamily (Cys-X-Cys
  • RSS
  • YouTube
  • Linkedin
  • Facebook