Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC35A1 (Human) Recombinant Protein (P01)

  • Catalog # : H00010559-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC35A1 full-length ORF ( NP_006407.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 63.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010559-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SLC35A1
  • Gene Alias:
  • CMPST,CST,hCST,inactive
  • Gene Description:
  • solute carrier family 35 (CMP-sialic acid transporter), member A1
  • Gene Summary:
  • The SLC35A1 gene encodes a CMP-sialic acid transporter located within the membrane of the Golgi apparatus. The transporter moves nucleotide sugars across the membrane for use in glycosylation reactions that take place within the Golgi department (Eckhardt et al., 1996 [PubMed 8755516]). For background information on the SLC35 family of nucleotide-sugar transporters, see SLC35A3 (MIM 605632).[supplied by OMIM
  • Other Designations:
  • CMP-sialic acid transporter,OTTHUMP00000016832,OTTHUMP00000040610,mutated CMP-sialic acid transporter A1,solute carrier family 35 (CMP-sialic acid transporter), member 1,solute carrier family 35 (UDP-galactose transporter), member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook