Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AGPAT1 (Human) Recombinant Protein (P01)

  • Catalog # : H00010554-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AGPAT1 full-length ORF ( NP_006402.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 58.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010554-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • AGPAT1
  • Gene Alias:
  • 1-AGPAT1,G15,LPAAT-alpha,LPAATA,MGC4007,MGC5423
  • Gene Description:
  • 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)
  • Gene Summary:
  • This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq
  • Other Designations:
  • 1-AGP acyltransferase 1,1-acylglycerol-3-phosphate O-acyltransferase 1,1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase),OTTHUMP00000029298,OTTHUMP00000029299,OTTHUMP00000029300,OTTHUMP00000029301,OTTHUMP00000029302,OTTHUMP0
  • RSS
  • YouTube
  • Linkedin
  • Facebook