Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AGPAT1 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00010554-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human AGPAT1 protein.
  • Immunogen:
  • AGPAT1 (NP_006402.1, 1 a.a. ~ 283 a.a) full-length human protein.
  • Sequence:
  • MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AGPAT1 expression in transfected 293T cell line (H00010554-T02) by AGPAT1 MaxPab polyclonal antibody.

    Lane 1: AGPAT1 transfected lysate(31.13 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • AGPAT1
  • Gene Alias:
  • 1-AGPAT1,G15,LPAAT-alpha,LPAATA,MGC4007,MGC5423
  • Gene Description:
  • 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)
  • Gene Summary:
  • This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq
  • Other Designations:
  • 1-AGP acyltransferase 1,1-acylglycerol-3-phosphate O-acyltransferase 1,1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase),OTTHUMP00000029298,OTTHUMP00000029299,OTTHUMP00000029300,OTTHUMP00000029301,OTTHUMP00000029302,OTTHUMP0
  • RSS
  • YouTube
  • Linkedin
  • Facebook