ARL6IP5 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ARL6IP5 partial ORF ( NP_006398, 1 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.78
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ARL6IP5
Entrez GeneID
10550GeneBank Accession#
NM_006407Protein Accession#
NP_006398Gene Name
ARL6IP5
Gene Alias
DERP11, GTRAP3-18, HSPC127, JWA, PRAF3, addicsin, hp22, jmx
Gene Description
ADP-ribosylation-like factor 6 interacting protein 5
Omim ID
605709Gene Ontology
HyperlinkGene Summary
Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq
Other Designations
PRA1 domain family 3|cytoskeleton related vitamin A responsive protein|dermal papilla derived protein 11|glutamate transporter EEAC1-associated protein|putative MAPK activating protein PM27
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com