Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARL6IP5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010550-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ARL6IP5 partial ORF ( NP_006398, 1 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.78
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010550-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ARL6IP5
  • Gene Alias:
  • DERP11,GTRAP3-18,HSPC127,JWA,PRAF3,addicsin,hp22,jmx
  • Gene Description:
  • ADP-ribosylation-like factor 6 interacting protein 5
  • Gene Summary:
  • Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq
  • Other Designations:
  • PRA1 domain family 3,cytoskeleton related vitamin A responsive protein,dermal papilla derived protein 11,glutamate transporter EEAC1-associated protein,putative MAPK activating protein PM27
  • RSS
  • YouTube
  • Linkedin
  • Facebook