Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARL6IP5 polyclonal antibody (A01)

  • Catalog # : H00010550-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ARL6IP5.
  • Immunogen:
  • ARL6IP5 (NP_006398, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010550-A01
    Western Blot detection against Immunogen (33.15 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ARL6IP5
  • Gene Alias:
  • DERP11,GTRAP3-18,HSPC127,JWA,PRAF3,addicsin,hp22,jmx
  • Gene Description:
  • ADP-ribosylation-like factor 6 interacting protein 5
  • Gene Summary:
  • Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq
  • Other Designations:
  • PRA1 domain family 3,cytoskeleton related vitamin A responsive protein,dermal papilla derived protein 11,glutamate transporter EEAC1-associated protein,putative MAPK activating protein PM27
  • RSS
  • YouTube
  • Linkedin
  • Facebook