PRDX4 monoclonal antibody (M01), clone 2C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRDX4.
Immunogen
PRDX4 (AAH03609, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CHFFAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PRDX4 monoclonal antibody (M01), clone 2C12. Western Blot analysis of PRDX4 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of PRDX4 expression in transfected 293T cell line by PRDX4 monoclonal antibody (M01), clone 2C12.
Lane 1: PRDX4 transfected lysate(30.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PRDX4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRDX4 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — PRDX4
Entrez GeneID
10549GeneBank Accession#
BC003609Protein Accession#
AAH03609Gene Name
PRDX4
Gene Alias
AOE37-2, PRX-4
Gene Description
peroxiredoxin 4
Omim ID
606506Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. [provided by RefSeq
Other Designations
OTTHUMP00000023056|thioredoxin peroxidase|thioredoxin peroxidase (antioxidant enzyme)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com