PRDX4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PRDX4 MaxPab polyclonal antibody. Western Blot analysis of PRDX4 expression in human kidney.
Western Blot (Cell lysate)
PRDX4 MaxPab polyclonal antibody. Western Blot analysis of PRDX4 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of PRDX4 expression in transfected 293T cell line (H00010549-T01) by PRDX4 MaxPab polyclonal antibody.
Lane 1: PRDX4 transfected lysate(29.81 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PRDX4 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PRDX4 protein.
Immunogen
PRDX4 (NP_006397, 1 a.a. ~ 271 a.a) full-length human protein.
Sequence
MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PRDX4 MaxPab polyclonal antibody. Western Blot analysis of PRDX4 expression in human kidney.Western Blot (Cell lysate)
PRDX4 MaxPab polyclonal antibody. Western Blot analysis of PRDX4 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of PRDX4 expression in transfected 293T cell line (H00010549-T01) by PRDX4 MaxPab polyclonal antibody.
Lane 1: PRDX4 transfected lysate(29.81 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PRDX4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PRDX4
Entrez GeneID
10549GeneBank Accession#
NM_006406Protein Accession#
NP_006397Gene Name
PRDX4
Gene Alias
AOE37-2, PRX-4
Gene Description
peroxiredoxin 4
Omim ID
606506Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. [provided by RefSeq
Other Designations
OTTHUMP00000023056|thioredoxin peroxidase|thioredoxin peroxidase (antioxidant enzyme)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com