HBXIP monoclonal antibody (M12), clone 4G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HBXIP monoclonal antibody (M12), clone 4G1. Western Blot analysis of HBXIP expression in Jurkat.
Western Blot (Cell lysate)
HBXIP monoclonal antibody (M12), clone 4G1. Western Blot analysis of HBXIP expression in A-431.
Western Blot (Cell lysate)
HBXIP monoclonal antibody (M12), clone 4G1. Western Blot analysis of HBXIP expression in MCF-7.
Western Blot (Transfected lysate)
Western Blot analysis of HBXIP expression in transfected 293T cell line by HBXIP monoclonal antibody (M12), clone 4G1.
Lane 1: HBXIP transfected lysate(10.12 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HBXIP is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to HBXIP on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.75 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant HBXIP.
Immunogen
HBXIP (AAH62619, 83 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (80); Rat (76)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HBXIP monoclonal antibody (M12), clone 4G1. Western Blot analysis of HBXIP expression in Jurkat.Western Blot (Cell lysate)
HBXIP monoclonal antibody (M12), clone 4G1. Western Blot analysis of HBXIP expression in A-431.Western Blot (Cell lysate)
HBXIP monoclonal antibody (M12), clone 4G1. Western Blot analysis of HBXIP expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of HBXIP expression in transfected 293T cell line by HBXIP monoclonal antibody (M12), clone 4G1.
Lane 1: HBXIP transfected lysate(10.12 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HBXIP is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HBXIP on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — HBXIP
Entrez GeneID
10542GeneBank Accession#
BC062619Protein Accession#
AAH62619Gene Name
HBXIP
Gene Alias
MGC71071, XIP
Gene Description
hepatitis B virus x interacting protein
Omim ID
608521Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq
Other Designations
HBx-interacting protein|hepatitis B virus x-interacting protein|hepatitis B virus x-interacting protein (9.6kD)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com