GLRX3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GLRX3 protein.
Immunogen
GLRX3 (NP_006532.2, 1 a.a. ~ 335 a.a) full-length human protein.
Sequence
MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GLRX3 MaxPab rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in human pancreas.Western Blot (Tissue lysate)
GLRX3 MaxPab rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in human liver.Western Blot (Tissue lysate)
GLRX3 MaxPab rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in mouse liver.Western Blot (Cell lysate)
GLRX3 MaxPab rabbit polyclonal antibody. Western Blot analysis of GLRX3 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of GLRX3 expression in transfected 293T cell line (H00010539-T02) by GLRX3 MaxPab polyclonal antibody.
Lane 1: GLRX3 transfected lysate(37.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GLRX3
Entrez GeneID
10539GeneBank Accession#
NM_006541.2Protein Accession#
NP_006532.2Gene Name
GLRX3
Gene Alias
FLJ11864, GLRX4, GRX3, GRX4, PICOT, TXNL2, TXNL3, bA500G10.4
Gene Description
glutaredoxin 3
Gene Ontology
HyperlinkOther Designations
OTTHUMP00000020746|OTTHUMP00000020747|PKC-interacting cousin of thioredoxin|glutaredoxin 4|thioredoxin-like 2
-
Interactome
-
Disease
-
Publication Reference
-
Redox proteins are constitutively secreted by skeletal muscle.
Manabe Y, Takagi M, Nakamura-Yamada M, Goto-Inoue N, Taoka M, Isobe T, Fujii NL.
The Journal of Physiological Sciences 2014 Nov; 64(6):401.
Application:WB, Mouse, C2C12 myotube culture medium.
-
Redox proteins are constitutively secreted by skeletal muscle.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com