Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BATF (Human) Recombinant Protein (Q01)

  • Catalog # : H00010538-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BATF partial ORF ( NP_006390, 34 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.86
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010538-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • BATF
  • Gene Alias:
  • B-ATF,BATF1,SFA-2,SFA2
  • Gene Description:
  • basic leucine zipper transcription factor, ATF-like
  • Gene Summary:
  • The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq
  • Other Designations:
  • SF-HT-activated gene 2,activating transcription factor B
  • RSS
  • YouTube
  • Linkedin
  • Facebook