BATF monoclonal antibody (M01), clone 8A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BATF monoclonal antibody (M01), clone 8A12 Western Blot analysis of BATF expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M01), clone 8A12.
Lane 1: BATF transfected lysate(14.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of BATF transfected lysate using anti-BATF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BATF MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BATF is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.86 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BATF.
Immunogen
BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BATF monoclonal antibody (M01), clone 8A12 Western Blot analysis of BATF expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M01), clone 8A12.
Lane 1: BATF transfected lysate(14.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of BATF transfected lysate using anti-BATF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BATF MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BATF is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — BATF
Entrez GeneID
10538GeneBank Accession#
NM_006399Protein Accession#
NP_006390Gene Name
BATF
Gene Alias
B-ATF, BATF1, SFA-2, SFA2
Gene Description
basic leucine zipper transcription factor, ATF-like
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq
Other Designations
SF-HT-activated gene 2|activating transcription factor B
-
Interactome
-
Publication Reference
-
Basic leucine zipper transcription factor, ATF-like (BATF) regulates epigenetically and energetically effector CD8 T-cell differentiation via Sirt1 expression.
Kuroda S, Yamazaki M, Abe M, Sakimura K, Takayanagi H, Iwai Y.
PNAS 2011 Sep; 108(36):14885.
Application：ChIP, WB-Ce, Mouse, T cells.
-
Basic leucine zipper transcription factor, ATF-like (BATF) regulates epigenetically and energetically effector CD8 T-cell differentiation via Sirt1 expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com