NOL5A (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NOL5A full-length ORF ( AAH04937.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.9
Interspecies Antigen Sequence
Mouse (68); Rat (71)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NOP56
Entrez GeneID
10528GeneBank Accession#
BC004937.1Protein Accession#
AAH04937.1Gene Name
NOP56
Gene Alias
NOL5A
Gene Description
NOP56 ribonucleoprotein homolog (yeast)
Gene Ontology
HyperlinkGene Summary
Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. The protein encoded by this gene is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000030035|nucleolar protein 5A|nucleolar protein 5A (56kD with KKE/D repeat)|nucleolar protein 5A (56kDa with KKE/D repeat)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com