Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NOL5A (Human) Recombinant Protein (P01)

  • Catalog # : H00010528-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NOL5A full-length ORF ( AAH04937.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.9
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010528-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NOP56
  • Gene Alias:
  • NOL5A
  • Gene Description:
  • NOP56 ribonucleoprotein homolog (yeast)
  • Gene Summary:
  • Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. The protein encoded by this gene is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030035,nucleolar protein 5A,nucleolar protein 5A (56kD with KKE/D repeat),nucleolar protein 5A (56kDa with KKE/D repeat)
  • RSS
  • YouTube
  • Linkedin
  • Facebook