Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NOL5A purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00010528-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NOL5A protein.
  • Immunogen:
  • NOL5A (AAH04937, 49 a.a. ~ 174 a.a) full-length human protein.
  • Sequence:
  • PEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NOP56 expression in transfected 293T cell line (H00010528-T04) by NOP56 MaxPab polyclonal antibody.

    Lane 1: NOL5A transfected lysate(19.25 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • NOP56
  • Gene Alias:
  • NOL5A
  • Gene Description:
  • NOP56 ribonucleoprotein homolog (yeast)
  • Gene Summary:
  • Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. The protein encoded by this gene is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030035,nucleolar protein 5A,nucleolar protein 5A (56kD with KKE/D repeat),nucleolar protein 5A (56kDa with KKE/D repeat)
  • RSS
  • YouTube
  • Linkedin
  • Facebook