IPO7 monoclonal antibody (M07), clone 4G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
IPO7 monoclonal antibody (M07), clone 4G6. Western Blot analysis of IPO7 expression in HeLa(Cat # L013V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IPO7 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IPO7.
Immunogen
IPO7 (NP_006382.1, 950 a.a. ~ 1038 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IPO7 monoclonal antibody (M07), clone 4G6. Western Blot analysis of IPO7 expression in HeLa(Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IPO7 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — IPO7
Entrez GeneID
10527GeneBank Accession#
NM_006391Protein Accession#
NP_006382.1Gene Name
IPO7
Gene Alias
FLJ14581, Imp7, MGC138673, RANBP7
Gene Description
importin 7
Omim ID
605586Gene Ontology
HyperlinkGene Summary
The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. Similar to importin-beta, this protein prevents the activation of Ran's GTPase by RanGAP1 and inhibits nucleotide exchange on RanGTP, and also binds directly to nuclear pore complexes where it competes for binding sites with importin-beta and transportin. This protein has a Ran-dependent transport cycle and it can cross the nuclear envelope rapidly and in both directions. At least four importin beta-like transport receptors, namely importin beta itself, transportin, RanBP5 and RanBP7, directly bind and import ribosomal proteins. [provided by RefSeq
Other Designations
RAN binding protein 7|RAN-binding protein 7
-
Interactome
-
Disease
-
Publication Reference
-
The nuclear translocation of the kinases p38 and JNK promotes inflammation-induced cancer.
Maik-Rachline G, Zehorai E, Hanoch T, Blenis J, Seger R.
Science Signaling 2018 Apr; 11(525):eaao3428.
Application：WB, Human, HeLa cells.
-
Nuclear Extracellular Signal-Regulated Kinase 1 and 2 Translocation Is Mediated by Casein Kinase 2 and Accelerated by Autophosphorylation.
Plotnikov A, Chuderland D, Karamansha Y, Livnah O, Seger R.
Molecular and Cellular Biology 2011 Sep; 31(17):3515.
Application：WB-Ce, WB-Tr, Human, HeLa, HEK-293T cells.
-
The nuclear translocation of the kinases p38 and JNK promotes inflammation-induced cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com