IPO8 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IPO8 partial ORF ( NP_006381.2, 949 a.a. - 1037 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LDLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFENKGVLSAFNFGTVPSNN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.53
Interspecies Antigen Sequence
Mouse (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — IPO8
Entrez GeneID
10526GeneBank Accession#
NM_006390Protein Accession#
NP_006381.2Gene Name
IPO8
Gene Alias
FLJ26580, RANBP8
Gene Description
importin 8
Omim ID
605600Gene Ontology
HyperlinkGene Summary
The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. [provided by RefSeq
Other Designations
RAN binding protein 8
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com