IPO8 monoclonal antibody (M01), clone 3D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
IPO8 monoclonal antibody (M01), clone 3D5. Western Blot analysis of IPO8 expression in Hela S3 NE.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IPO8 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IPO8.
Immunogen
IPO8 (NP_006381.2, 949 a.a. ~ 1037 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LDLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFENKGVLSAFNFGTVPSNN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IPO8 monoclonal antibody (M01), clone 3D5. Western Blot analysis of IPO8 expression in Hela S3 NE.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IPO8 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — IPO8
Entrez GeneID
10526GeneBank Accession#
NM_006390Protein Accession#
NP_006381.2Gene Name
IPO8
Gene Alias
FLJ26580, RANBP8
Gene Description
importin 8
Omim ID
605600Gene Ontology
HyperlinkGene Summary
The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. [provided by RefSeq
Other Designations
RAN binding protein 8
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com