APPBP2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant APPBP2.
Immunogen
APPBP2 (NP_006371, 486 a.a. ~ 585 a.a) partial recombinant protein with GST tag.
Sequence
NQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQNVEGPSC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — APPBP2
Entrez GeneID
10513GeneBank Accession#
NM_006380Protein Accession#
NP_006371Gene Name
APPBP2
Gene Alias
HS.84084, KIAA0228, PAT1
Gene Description
amyloid beta precursor protein (cytoplasmic tail) binding protein 2
Omim ID
605324Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. This gene has been found to be highly expressed in breast cancer. Multiple polyadenylation sites have been found for this gene. [provided by RefSeq
Other Designations
amyloid beta precursor protein-binding protein 2|protein interacting with APP tail 1
-
Interactome
-
Publication Reference
-
The Kinesin Light Chain-Related Protein PAT1 Promotes Superoxide Anion Production in Human Phagocytes.
Arabi-Derkawi R, O'Dowd Y, Cheng N, Rolas L, Boussetta T, Raad H, Marzaioli V, Pintard C, Fasseu M, Kroviarski Y, Belambri SA, Dang PM, Ye RD, Gougerot-Pocidalo MA, El-Benna J.
Journal of immunology 2019 Mar; 202(5):1549.
Application：WB, Human, COSphox, Human neutrophils, Monocytes cells.
-
The Kinesin Light Chain-Related Protein PAT1 Promotes Superoxide Anion Production in Human Phagocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com