SEMA4D monoclonal antibody (M01), clone 3B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SEMA4D monoclonal antibody (M01), clone 3B4 Western Blot analysis of SEMA4D expression in HL-60 ( Cat # L014V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEMA4D is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SEMA4D.
Immunogen
SEMA4D (AAH54500, 115 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LQPLSATSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SEMA4D monoclonal antibody (M01), clone 3B4 Western Blot analysis of SEMA4D expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEMA4D is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — SEMA4D
Entrez GeneID
10507GeneBank Accession#
BC054500Protein Accession#
AAH54500Gene Name
SEMA4D
Gene Alias
C9orf164, CD100, FLJ33485, FLJ34282, FLJ39737, FLJ46484, M-sema-G, MGC169138, MGC169141, SEMAJ, coll-4
Gene Description
sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Omim ID
601866Gene Ontology
HyperlinkGene Summary
sema domain
Other Designations
OTTHUMP00000021622|OTTHUMP00000070035|sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, 4D|semaphorin 4D
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Phage Display Identification of CD100 in Human Atherosclerotic Plaque Macrophages and Foam Cells.
Luque MC, Gutierrez PS, Debbas V, Martins WK, Puech-Leao P, Porto G, Coelho V, Boumsell L, Kalil J, Stolf B.
PLoS One 2013 Sep; 8(9):e75772.
Application：IF, Human, Monocytes, Macrophages, Foam cells.
-
Phage Display Identification of CD100 in Human Atherosclerotic Plaque Macrophages and Foam Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com