Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SEMA6C polyclonal antibody (A01)

  • Catalog # : H00010500-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SEMA6C.
  • Immunogen:
  • SEMA6C (NP_112175, 28 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QDPLPLLISDLQGTSPLSWFRGLEDDAVAAELGLDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDECYNYIR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010500-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SEMA6C
  • Gene Alias:
  • SEMAY,m-SemaY,m-SemaY2
  • Gene Description:
  • sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6C
  • Gene Summary:
  • This gene product is a member of the semaphorin family of proteins. Semaphorins represent important molecular signals controlling multiple aspects of the cellular response that follows CNS injury, and thus may play an important role in neural regeneration. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000014154,OTTHUMP00000014157,semaphorin Y
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook