Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STK25 monoclonal antibody (M02), clone 4B10

  • Catalog # : H00010494-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant STK25.
  • Immunogen:
  • STK25 (AAH07852, 321 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • FPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG3 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STK25 monoclonal antibody (M02), clone 4B10 Western Blot analysis of STK25 expression in K-562 ( Cat # L009V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of STK25 expression in transfected 293T cell line by STK25 monoclonal antibody (M02), clone 4B10.

    Lane 1: STK25 transfected lysate (Predicted MW: 48.1 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of STK25 transfected lysate using anti-STK25 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with STK25 monoclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • STK25
  • Gene Alias:
  • DKFZp686J1430,SOK1,YSK1
  • Gene Description:
  • serine/threonine kinase 25 (STE20 homolog, yeast)
  • Other Designations:
  • Ste20, yeast homolog,serine/threonine kinase 25,serine/threonine kinase 25 (Ste20, yeast homolog),sterile 20 (oxidant stress response kinase 1; yeast Sps1/Ste20-related kinase 1)
  • RSS
  • YouTube
  • Linkedin
  • Facebook