STK25 monoclonal antibody (M01), clone 1G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STK25.
Immunogen
STK25 (AAH07852, 321 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STK25 monoclonal antibody (M01), clone 1G6. Western Blot analysis of STK25 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of STK25 expression in transfected 293T cell line by STK25 monoclonal antibody (M01), clone 1G6.
Lane 1: STK25 transfected lysate (Predicted MW: 48.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STK25 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — STK25
Entrez GeneID
10494GeneBank Accession#
BC007852Protein Accession#
AAH07852Gene Name
STK25
Gene Alias
DKFZp686J1430, SOK1, YSK1
Gene Description
serine/threonine kinase 25 (STE20 homolog, yeast)
Omim ID
602255Gene Ontology
HyperlinkGene Summary
O
Other Designations
Ste20, yeast homolog|serine/threonine kinase 25|serine/threonine kinase 25 (Ste20, yeast homolog)|sterile 20 (oxidant stress response kinase 1; yeast Sps1/Ste20-related kinase 1)
-
Interactome
-
Publication Reference
-
Differential expression of MST4, STK25 and PDCD10 between benign prostatic hyperplasia and prostate cancer.
Zhang H, Ma X, Peng S, Nan X, Zhao H.
International Journal of Clinical and Experimental Pathology 2014 Oct; 7(11):8105.
Application:IHC-P, Human, Benign prostatic hyperplasia, Prostate cancer.
-
Adaptor protein cerebral cavernous malformation 3 (CCM3) mediates phosphorylation of the cytoskeletal proteins ezrin/radixin/moesin by mammalian Ste20-4 to protect cells from oxidative stress.
Fidalgo M, Guerrero A, Fraile M, Iglesias C, Pombo CM, Zalvide J.
The journal of Biological Chemistry 2012 Mar; 287(14):11556.
Application:WB-Ce, Human, SaOS2 cells.
-
CCM3/PDCD10 stabilizes GCKIII proteins to promote Golgi assembly and cell orientation.
Fidalgo M, Fraile M, Pires A, Force T, Pombo C, Zalvide J.
Journal of Cell Science 2010 Apr; 123(Pt 8):1274.
Application:IP, WB-Tr, Human, HEK 293, SaOS2 cells.
-
Differential expression of MST4, STK25 and PDCD10 between benign prostatic hyperplasia and prostate cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com