CRTAP monoclonal antibody (M01), clone 4D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CRTAP monoclonal antibody (M01), clone 4D9 Western Blot analysis of CRTAP expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRTAP is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.19 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CRTAP.
Immunogen
CRTAP (NP_006362, 307 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CRTAP monoclonal antibody (M01), clone 4D9 Western Blot analysis of CRTAP expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRTAP is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CRTAP
Entrez GeneID
10491GeneBank Accession#
NM_006371Protein Accession#
NP_006362Gene Name
CRTAP
Gene Alias
CASP, LEPREL3
Gene Description
cartilage associated protein
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli. Defects in this gene are associated with osteogenesis imperfecta, a connective tissue disorder characterized by bone fragility and low bone mass. [provided by RefSeq
Other Designations
leprecan-like 3
-
Interactome
-
Publication Reference
-
Genetic analysis, phenotype spectrum and functional study of rare osteogenesis imperfecta caused by CRTAP Variants.
Bingna Zhou, Peng Gao, Jing Hu, Xiaoyun Lin, Lei Sun, Qian Zhang, Yan Jiang, Ou Wang, Weibo Xia, Xiaoping Xing, Mei Li.
The Journal of Clinical Endocrinology and Metabolism 2024 Jan; [Epub].
Application：WB, Human, Human Osteoblasts.
-
Targeted exome sequencing identifies novel compound heterozygous mutations in LEPRE1 in a fetus with osteogenesis imperfecta type VIII.
Huang Y, Mei L, Lv W, Li H, Zhang R, Pan Q, Tan H, Guo J, Luo X, Chen C, Liang D, Wu L.
Clinica Chimica Acta 2016 Nov; 464:170.
Application：WB, Human, PBMCs.
-
Severe osteogenesis imperfecta in cyclophilin B-deficient mice.
Choi JW, Sutor SL, Lindquist L, Evans GL, Madden BJ, Bergen HR 3rd, Hefferan TE, Yaszemski MJ, Bram RJ.
PLoS Genetics 2009 Dec; 5(12):e1000750.
Application：WB, Human, HeLa cells.
-
Prolyl 3-hydroxylase 1 and CRTAP are mutually stabilizing in the endoplasmic reticulum collagen prolyl 3-hydroxylation complex.
Chang W, Barnes AM, Cabral WA, Bodurtha JN, Marini JC.
Human Molecular Genetics 2010 Jan; 19(2):223.
Application：WB-Ce, WB-Tr, Human, Human fibroblasts.
-
Genetic analysis, phenotype spectrum and functional study of rare osteogenesis imperfecta caused by CRTAP Variants.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com