CREB3 monoclonal antibody (M01), clone 3H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CREB3.
Immunogen
CREB3 (NP_006359, 273 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (55)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CREB3 expression in transfected 293T cell line by CREB3 monoclonal antibody (M01), clone 3H5.
Lane 1: CREB3 transfected lysate(41.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CREB3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CREB3 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CREB3 over-expressed 293 cell line, cotransfected with CREB3 Validated Chimera RNAi ( Cat # H00010488-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CREB3 monoclonal antibody (M01), clone 3H5 (Cat # H00010488-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CREB3
Entrez GeneID
10488GeneBank Accession#
NM_006368Protein Accession#
NP_006359Gene Name
CREB3
Gene Alias
LUMAN, LZIP, MGC15333, MGC19782
Gene Description
cAMP responsive element binding protein 3
Omim ID
606443Gene Ontology
HyperlinkGene Summary
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000021348|basic leucine zipper protein|cyclic AMP response element (CRE)-binding protein/activating transcription factor 1|transcription factor LZIP-alpha
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com