Product Browser

Last updated: 2017/10/22
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CREB3 polyclonal antibody (A01)

  • Catalog # : H00010488-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CREB3.
  • Immunogen:
  • CREB3 (NP_006359, 273 a.a. ~ 371 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010488-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CREB3
  • Gene Alias:
  • LUMAN,LZIP,MGC15333,MGC19782
  • Gene Description:
  • cAMP responsive element binding protein 3
  • Gene Summary:
  • This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021348,basic leucine zipper protein,cyclic AMP response element (CRE)-binding protein/activating transcription factor 1,transcription factor LZIP-alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook