TADA3L purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TADA3L expression in transfected 293T cell line (H00010474-T02) by TADA3L MaxPab polyclonal antibody.
Lane 1: TADA3L transfected lysate(41.40 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TADA3L protein.
Immunogen
TADA3L (NP_597814.1, 1 a.a. ~ 369 a.a) full-length human protein.
Sequence
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLR
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TADA3L expression in transfected 293T cell line (H00010474-T02) by TADA3L MaxPab polyclonal antibody.
Lane 1: TADA3L transfected lysate(41.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TADA3L
Entrez GeneID
10474GeneBank Accession#
NM_133480.1Protein Accession#
NP_597814.1Gene Name
TADA3L
Gene Alias
ADA3, FLJ20221, FLJ21329, hADA3
Gene Description
transcriptional adaptor 3 (NGG1 homolog, yeast)-like
Omim ID
602945Gene Ontology
HyperlinkGene Summary
Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least four alternatively spliced variants have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq
Other Designations
transcriptional adaptor 3-like
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com