HMGN4 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HMGN4 full-length ORF ( AAH01282, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.64
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HMGN4
Entrez GeneID
10473GeneBank Accession#
BC001282Protein Accession#
AAH01282Gene Name
HMGN4
Gene Alias
HMG17L3, MGC5145, NHC
Gene Description
high mobility group nucleosomal binding domain 4
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000016171|high mobility group protein N4|high-mobility group (nonhistone chromosomal) protein 17-like 3|high-mobility group protein 17-like 3|non-histone chromosomal protein
-
Interactome
-
Publication Reference
-
Serine ADP-Ribosylation Depends on HPF1.
Bonfiglio JJ, Fontana P, Zhang Q, Colby T, Gibbs-Seymour I, Atanassov I, Bartlett E Zaja R, Ahel I, Matic I.
Molecular Cell 2017 Mar; 65(5):932.
Application:Func, Recombinant protein.
-
Serine ADP-Ribosylation Depends on HPF1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com