Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNF238 monoclonal antibody (M04), clone 4E4

  • Catalog # : H00010472-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ZNF238.
  • Immunogen:
  • ZNF238 (NP_991331.1, 182 a.a. ~ 281 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010472-M04
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ZNF238 is 1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • ZNF238
  • Gene Alias:
  • C2H2-171,RP58,TAZ-1,ZBTB18
  • Gene Description:
  • zinc finger protein 238
  • Gene Summary:
  • C2H2-type zinc finger proteins, such as ZNF238, act on the molecular level as transcriptional activators or repressors and are involved in chromatin assembly.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000037918,zinc finger protein C2H2-171
  • RSS
  • YouTube
  • Linkedin
  • Facebook