PPIH (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPIH full-length ORF ( AAH03412, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.21
Interspecies Antigen Sequence
Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPIH
Entrez GeneID
10465GeneBank Accession#
BC003412Protein Accession#
AAH03412Gene Name
PPIH
Gene Alias
CYP-20, CYPH, MGC5016, SnuCyp-20, USA-CYP
Gene Description
peptidylprolyl isomerase H (cyclophilin H)
Omim ID
606095Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. [provided by RefSeq
Other Designations
OTTHUMP00000008725|PPIase h|U-snRNP-associated cyclophilin SunCyp-20|USA-CyP SnuCyp-20|cyclophilin H|peptidyl-prolyl cis-trans isomerase H|peptidylprolyl isomerase H|rotamase H|small nuclear ribonucleoprotein particle-specific cyclophilin H
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com