Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIH (Human) Recombinant Protein (P01)

  • Catalog # : H00010465-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPIH full-length ORF ( AAH03412, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.21
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010465-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PPIH
  • Gene Alias:
  • CYP-20,CYPH,MGC5016,SnuCyp-20,USA-CYP
  • Gene Description:
  • peptidylprolyl isomerase H (cyclophilin H)
  • Gene Summary:
  • The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000008725,PPIase h,U-snRNP-associated cyclophilin SunCyp-20,USA-CyP SnuCyp-20,cyclophilin H,peptidyl-prolyl cis-trans isomerase H,peptidylprolyl isomerase H,rotamase H,small nuclear ribonucleoprotein particle-specific cyclophilin H
  • RSS
  • YouTube
  • Linkedin
  • Facebook