PIBF1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PIBF1 partial ORF ( NP_006337, 660 a.a. - 755 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.3
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PIBF1
Entrez GeneID
10464GeneBank Accession#
NM_006346Protein Accession#
NP_006337Gene Name
PIBF1
Gene Alias
C13orf24, KIAA1008, PIBF, RP11-505F3.1
Gene Description
progesterone immunomodulatory binding factor 1
Omim ID
607532Gene Ontology
HyperlinkOther Designations
progesterone-induced blocking factor 1
-
Interactome
-
Disease
-
Publication Reference
-
Interleukin-33-induced expression of PIBF1 by decidual B cells protects against preterm labor.
Huang B, Faucette AN, Pawlitz MD, Pei B, Goyert JW, Zhou JZ, El-Hage NG, Deng J, Lin J, Yao F, Dewar RS 3rd, Jassal JS, Sandberg ML, Dai J, Cols M, Shen C, Polin LA, Nichols RA, Jones TB, Bluth MH, Puder KS, Gonik B, Nayak NR, Puscheck E, Wei WZ, Cerutti A, Colonna M, Chen K.
Nature Medicine 2016 Dec; 23(1):128.
Application:Func, Mouse, Mouse uterine neutrophils.
-
Interleukin-33-induced expression of PIBF1 by decidual B cells protects against preterm labor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com