MERTK monoclonal antibody (M01), clone 2D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MERTK.
Immunogen
MERTK (NP_006334, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (55); Rat (56)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MERTK is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — MERTK
Entrez GeneID
10461GeneBank Accession#
NM_006343Protein Accession#
NP_006334Gene Name
MERTK
Gene Alias
MER, MGC133349, RP38, c-mer
Gene Description
c-mer proto-oncogene tyrosine kinase
Gene Ontology
HyperlinkGene Summary
This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP). [provided by RefSeq
Other Designations
MER receptor tyrosine kinase|STK kinase
-
Interactome
-
Disease
-
Publication Reference
-
Crosstalk of protein clearance, inflammasome, and Ca2+ channels in retinal pigment epithelium derived from age-related macular degeneration patients.
Viivi Karema-Jokinen, Ali Koskela, Maria Hytti, Heidi Hongisto, Taina Viheriälä, Mikko Liukkonen, Tommi Torsti, Heli Skottman, Anu Kauppinen, Soile Nymark, Kai Kaarniranta.
The Journal of Biological Chemistry 2023 Jun; 299(6):104770.
Application:IF, Human, iPSC-derived retinal pigment epithelium cells.
-
Poly(trimethylene carbonate) as an elastic biodegradable film for human embryonic stem cell-derived retinal pigment epithelial cells.
Sorkio A, Haimi S, Verdoold V, Juuti-Uusitalo K, Grijpma D, Skottman H.
Journal of Tissue Engineering and Regenerative Medicine 2017 Jan; [Epub].
Application:IF, Human, Human embryonic stem cell-derived retinal pigment epithelial cells.
-
Biomimetic collagen I and IV double layer Langmuir-Schaefer films as microenvironment for human pluripotent stem cell derived retinal pigment epithelial cells.
Sorkio AE, Vuorimaa-Laukkanen EP, Hakola HM, Liang H, Ujula TA, Valle-Delgado JJ, Osterberg M, Yliperttula ML, Skottman H.
Biomaterials 2015 May; 51:257.
Application:IF, Human, hESC-RPE cells.
-
Generation of hESC-derived retinal pigment epithelium on biopolymer coated polyimide membranes.
Subrizi A, Hiidenmaa H, Ilmarinen T, Nymark S, Dubruel P, Uusitalo H, Yliperttula M, Urtti A, Skottman H.
Biomaterials 2012 Nov; 33(32):8047.
Application:ICC, IF, Human, hESC-RPE.
-
Crosstalk of protein clearance, inflammasome, and Ca2+ channels in retinal pigment epithelium derived from age-related macular degeneration patients.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com