TACC3 monoclonal antibody (M02), clone 6C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TACC3.
Immunogen
TACC3 (NP_006333, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (66); Rat (75)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TACC3 monoclonal antibody (M02), clone 6C4. Western Blot analysis of TACC3 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
TACC3 monoclonal antibody (M02), clone 6C4 Western Blot analysis of TACC3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TACC3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TACC3 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — TACC3
Entrez GeneID
10460GeneBank Accession#
NM_006342Protein Accession#
NP_006333Gene Name
TACC3
Gene Alias
ERIC1, MGC117382, MGC133242
Gene Description
transforming, acidic coiled-coil containing protein 3
Omim ID
605303Gene Ontology
HyperlinkGene Summary
The function of this gene has not yet been determined; however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com