BAIAP2 monoclonal antibody (M01), clone 3F3-2D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of BAIAP2 expression in transfected 293T cell line by BAIAP2 monoclonal antibody (M01), clone 3F3-2D3.
Lane 1: BAIAP2 transfected lysate(57 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of BAIAP2 transfected lysate using anti-BAIAP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BAIAP2 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BAIAP2 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (82.06 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant BAIAP2.
Immunogen
BAIAP2 (AAH32559, 1 a.a. ~ 512 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (82.06 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BAIAP2 expression in transfected 293T cell line by BAIAP2 monoclonal antibody (M01), clone 3F3-2D3.
Lane 1: BAIAP2 transfected lysate(57 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of BAIAP2 transfected lysate using anti-BAIAP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BAIAP2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BAIAP2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — BAIAP2
Entrez GeneID
10458GeneBank Accession#
BC032559Protein Accession#
AAH32559Gene Name
BAIAP2
Gene Alias
BAP2, IRSP53
Gene Description
BAI1-associated protein 2
Omim ID
605475Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms
Other Designations
insulin receptor substrate p53
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com