Product Browser

Last updated: 2017/11/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOMM40 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010452-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TOMM40 partial ORF ( NP_006105, 276 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • HKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010452-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TOMM40
  • Gene Alias:
  • C19orf1,D19S1177E,PER-EC1,PEREC1,TOM40
  • Gene Description:
  • translocase of outer mitochondrial membrane 40 homolog (yeast)
  • Gene Summary:
  • TOMM40 is the channel-forming subunit of the translocase of the mitochondrial outer membrane (TOM) complex that is essential for protein import into mitochondria (Humphries et al., 2005 [PubMed 15644312]).[supplied by OMIM
  • Other Designations:
  • mitochondrial outer membrane protein,translocase of outer mitochondrial membrane 40
  • RSS
  • YouTube
  • Linkedin
  • Facebook