PPIE (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPIE full-length ORF ( NP_006103.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
59.8
Interspecies Antigen Sequence
Mouse (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPIE
Entrez GeneID
10450GeneBank Accession#
NM_006112.2Protein Accession#
NP_006103.1Gene Name
PPIE
Gene Alias
CYP-33, MGC111222, MGC3736
Gene Description
peptidylprolyl isomerase E (cyclophilin E)
Omim ID
602435Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
OTTHUMP00000010837|OTTHUMP00000010838|PPIase E|cyclophilin 33|cyclophilin E|peptidyl-prolyl cis-trans isomerase E|peptidylprolyl isomerase E|peptidylprolyl isomerase E, isoform 1|rotamase E
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com