PPIE MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PPIE protein.
Immunogen
PPIE (NP_006103.1, 1 a.a. ~ 301 a.a) full-length human protein.
Sequence
MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Tissue lysate)
PPIE MaxPab polyclonal antibody. Western Blot analysis of PPIE expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of PPIE expression in transfected 293T cell line (H00010450-T01) by PPIE MaxPab polyclonal antibody.
Lane 1: PPIE transfected lysate(33.11 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to PPIE on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PPIE on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PPIE
Entrez GeneID
10450GeneBank Accession#
NM_006112.2Protein Accession#
NP_006103.1Gene Name
PPIE
Gene Alias
CYP-33, MGC111222, MGC3736
Gene Description
peptidylprolyl isomerase E (cyclophilin E)
Omim ID
602435Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
OTTHUMP00000010837|OTTHUMP00000010838|PPIase E|cyclophilin 33|cyclophilin E|peptidyl-prolyl cis-trans isomerase E|peptidylprolyl isomerase E|peptidylprolyl isomerase E, isoform 1|rotamase E
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com