PPIE polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PPIE.
Immunogen
PPIE (NP_006103, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Sequence
ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDD
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPIE polyclonal antibody (A01), Lot # 060524JCS1 Western Blot analysis of PPIE expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
PPIE polyclonal antibody (A01), Lot # 060524JCS1. Western Blot analysis of PPIE expression in PC-12.Western Blot (Cell lysate)
PPIE polyclonal antibody (A01), Lot # 060524JCS1. Western Blot analysis of PPIE expression in NIH/3T3.Western Blot (Cell lysate)
PPIE polyclonal antibody (A01), Lot # 060524JCS1. Western Blot analysis of PPIE expression in Raw 264.7.Western Blot (Recombinant protein)
ELISA
-
Gene Info — PPIE
Entrez GeneID
10450GeneBank Accession#
NM_006112Protein Accession#
NP_006103Gene Name
PPIE
Gene Alias
CYP-33, MGC111222, MGC3736
Gene Description
peptidylprolyl isomerase E (cyclophilin E)
Omim ID
602435Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
OTTHUMP00000010837|OTTHUMP00000010838|PPIase E|cyclophilin 33|cyclophilin E|peptidyl-prolyl cis-trans isomerase E|peptidylprolyl isomerase E|peptidylprolyl isomerase E, isoform 1|rotamase E
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com