ACAA2 monoclonal antibody (M01), clone 5C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ACAA2 monoclonal antibody (M01), clone 5C4 Western Blot analysis of ACAA2 expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACAA2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACAA2 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACAA2 on HeLa cell. [antibody concentration 40 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACAA2.
Immunogen
ACAA2 (NP_006102, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (87)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACAA2 monoclonal antibody (M01), clone 5C4 Western Blot analysis of ACAA2 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACAA2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACAA2 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACAA2 on HeLa cell. [antibody concentration 40 ug/ml] -
Gene Info — ACAA2
Entrez GeneID
10449GeneBank Accession#
NM_006111Protein Accession#
NP_006102Gene Name
ACAA2
Gene Alias
DSAEC, FLJ35992, FLJ95265
Gene Description
acetyl-Coenzyme A acyltransferase 2
Omim ID
604770Gene Ontology
HyperlinkGene Summary
The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq
Other Designations
acetyl-coenzyme A acyltransferase 2|beta ketothiolase|mitochondrial 3-oxoacyl-CoA thiolase|mitochondrial 3-oxoacyl-Coenzyme A thiolase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Opposing effects of dietary sugar and saturated fat on cardiovascular risk factors and glucose metabolism in mitochondrially impaired mice.
Kuhlow D, Zarse K, Voigt A, Schulz TJ, Petzke KJ, Schomburg L, Pfeiffer AF, Ristow M.
European Journal of Nutrition 2010 Oct; 49(7):417.
Application：WB-Ti, Mouse, Mouse hepatic tissues.
-
Opposing effects of dietary sugar and saturated fat on cardiovascular risk factors and glucose metabolism in mitochondrially impaired mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com