Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OLFM1 (Human) Recombinant Protein (P01)

  • Catalog # : H00010439-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human OLFM1 full-length ORF ( AAH00189, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.33
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010439-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • OLFM1
  • Gene Alias:
  • AMY,NOE1,NOELIN1,OlfA
  • Gene Description:
  • olfactomedin 1
  • Gene Summary:
  • This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022526,OTTHUMP00000022527,neuroblastoma protein,noelin,olfactomedin related ER localized protein,pancortin 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook