Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C1D (Human) Recombinant Protein (P02)

  • Catalog # : H00010438-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human C1D full-length ORF ( AAH05235, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 41.25
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010438-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • C1D
  • Gene Alias:
  • MGC12261,MGC14659,SUNCOR
  • Gene Description:
  • nuclear DNA-binding protein
  • Gene Summary:
  • The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined. [provided by RefSeq
  • Other Designations:
  • C1D DNA-binding protein,small unique nuclear receptor corepressor
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook