CDC42EP2 monoclonal antibody (M01), clone 2H7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CDC42EP2 expression in transfected 293T cell line by CDC42EP2 monoclonal antibody (M01), clone 2H7.
Lane 1: CDC42EP2 transfected lysate(22.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDC42EP2.
Immunogen
CDC42EP2 (NP_006770, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (86)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDC42EP2 expression in transfected 293T cell line by CDC42EP2 monoclonal antibody (M01), clone 2H7.
Lane 1: CDC42EP2 transfected lysate(22.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — CDC42EP2
Entrez GeneID
10435GeneBank Accession#
NM_006779Protein Accession#
NP_006770Gene Name
CDC42EP2
Gene Alias
BORG1, CEP2
Gene Description
CDC42 effector protein (Rho GTPase binding) 2
Omim ID
606132Gene Ontology
HyperlinkGene Summary
CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of, CDC42. Coexpression of this protein with dominant negative mutant CDC42 protein in fibroblast was found to induce pseudopodia formation, which suggested a role of this protein in actin filament assembly and cell shape control. [provided by RefSeq
Other Designations
CRIB-containing BOGR1 protein|Cdc42 effector protein 2
-
Interactome
-
Publication Reference
-
Protein array analysis of oligomerization-induced changes in alpha-synuclein protein-protein interactions points to an interference with CDC42 effector proteins.
Schnack C, Danzer KM, Hengerer B, Gillardon F.
Neuroscience 2008 Feb; 154(4):1450.
Application：IF, WB, Human, Mouse, Patients with Parkinson’s disease, Mouse brains.
-
Protein array analysis of oligomerization-induced changes in alpha-synuclein protein-protein interactions points to an interference with CDC42 effector proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com