Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LYPLA1 (Human) Recombinant Protein (Q03)

  • Catalog # : H00010434-Q03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LYPLA1 partial ORF ( AAH08652.1, 66 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRAS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010434-Q03
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • LYPLA1
  • Gene Alias:
  • APT-1,LPL1,LYSOPLA
  • Gene Description:
  • lysophospholipase I
  • Gene Summary:
  • Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq
  • Other Designations:
  • acyl-protein thioesterase-1,lysophospholipase 1,lysophospholipid-specific lysophospholipase
  • RSS
  • YouTube
  • Linkedin
  • Facebook