PGRMC2 monoclonal antibody (M04), clone 3C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant PGRMC2.
Immunogen
PGRMC2 (NP_006311, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (87); Rat (87)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PGRMC2 monoclonal antibody (M04), clone 3C11. Western Blot analysis of PGRMC2 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PGRMC2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PGRMC2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — PGRMC2
-
Interactomes
-
Diseases
-
Publication Reference
-
Progesterone receptor membrane component 1 as a potential prognostic biomarker for hepatocellular carcinoma.
Tsai HW, Ho CL, Cheng SW, Lin YJ, Chen CC, Cheng PN, Yen CJ, Chang TT, Chiang PM, Chan SH, Ho CH, Chen SH, Wang YW, Chow NH, Lin JC.
World Journal of Gastroenterology 2018 Mar; 24(10):1152.
Application:IHC-Fr, IHC-P, WB-Tr, Human, Hep3B, HepG2, Huh7 cells, Human hepatocellular carcinoma, PLC/PRF/5 cells.
-
Alterations in progesterone receptor membrane component 2 (PGRMC2) in the endometrium of macaques afflicted with advanced endometriosis.
Keator CS, Mah K, Slayden OD.
Molecular Human Reproduction 2012 Jun; 18(6):308.
Application:IHC-P, Monkey, Macaque endometrium.
-
Progesterone receptor membrane component 1 as a potential prognostic biomarker for hepatocellular carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com